MCOLN1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB575440
- Bilder (7)
| Artikelname: | MCOLN1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB575440 |
| Hersteller Artikelnummer: | orb575440 |
| Alternativnummer: | BYT-ORB575440-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human MCOLN1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ML1, ML4, MG-2, MLIV, MST080, TRPML1, MSTP080, TRP-ML1, TRPM-L1 |
| Rabbit polyclonal antibody to MCOLN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 64 kDa |
| NCBI: | 065394 |
| UniProt: | Q9GZU1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
| Target-Kategorie: | MCOLN1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. MCOLN1 can be glycosylated among other modifications. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-MCOLN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
