MCOLN1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB575440
- Images (7)
| Article Name: | MCOLN1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB575440 |
| Supplier Catalog Number: | orb575440 |
| Alternative Catalog Number: | BYT-ORB575440-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human MCOLN1 |
| Conjugation: | Unconjugated |
| Alternative Names: | ML1, ML4, MG-2, MLIV, MST080, TRPML1, MSTP080, TRP-ML1, TRPM-L1 |
| Rabbit polyclonal antibody to MCOLN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 64 kDa |
| NCBI: | 065394 |
| UniProt: | Q9GZU1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
| Target: | MCOLN1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. MCOLN1 can be glycosylated among other modifications. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-MCOLN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
