SSX4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB575622
- Bilder (7)
| Artikelname: | SSX4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB575622 |
| Hersteller Artikelnummer: | orb575622 |
| Alternativnummer: | BYT-ORB575622-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SSX4 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT5.4 |
| Rabbit polyclonal antibody to SSX4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 22kDa |
| NCBI: | 005627 |
| UniProt: | O60224 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: FPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGP |
| Target-Kategorie: | SSX4 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SSX4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. |
|
|
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SSX4 antibody (orb575622). |
|
|
WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
