SSX4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB575622
- Images (7)
| Article Name: | SSX4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB575622 |
| Supplier Catalog Number: | orb575622 |
| Alternative Catalog Number: | BYT-ORB575622-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SSX4 |
| Conjugation: | Unconjugated |
| Alternative Names: | CT5.4 |
| Rabbit polyclonal antibody to SSX4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 22kDa |
| NCBI: | 005627 |
| UniProt: | O60224 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: FPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGP |
| Target: | SSX4 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SSX4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. |
|
|
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SSX4 antibody (orb575622). |
|
|
WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
