JAZF1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB575886
- Bilder (7)
| Artikelname: | JAZF1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB575886 |
| Hersteller Artikelnummer: | orb575886 |
| Alternativnummer: | BYT-ORB575886-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TIP27, ZNF802 |
| Rabbit polyclonal antibody to JAZF1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 27kDa |
| NCBI: | 778231 |
| UniProt: | Q86VZ6 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT |
| Target-Kategorie: | JAZF1 |
|
|
Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: NTERA2, Antibody Dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
