JAZF1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB575886
- Images (7)
| Article Name: | JAZF1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB575886 |
| Supplier Catalog Number: | orb575886 |
| Alternative Catalog Number: | BYT-ORB575886-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1 |
| Conjugation: | Unconjugated |
| Alternative Names: | TIP27, ZNF802 |
| Rabbit polyclonal antibody to JAZF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 27kDa |
| NCBI: | 778231 |
| UniProt: | Q86VZ6 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT |
| Target: | JAZF1 |
|
|
Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: NTERA2, Antibody Dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
