TGFB1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576457
- Bilder (7)
| Artikelname: | TGFB1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576457 |
| Hersteller Artikelnummer: | orb576457 |
| Alternativnummer: | BYT-ORB576457-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IF, IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1 |
| Rabbit polyclonal antibody to TGF beta 1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 43kDa |
| NCBI: | 035707 |
| UniProt: | P04202 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS |
| Target-Kategorie: | TGFB1 |
|
|
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml. |
|
|
Human Spleen |
|
|
Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml. |
|
|
TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml. |
|
|
WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate. |
Produktgarantie und fachkundiger Support
