TGFB1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB576457
- Images (7)
| Article Name: | TGFB1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB576457 |
| Supplier Catalog Number: | orb576457 |
| Alternative Catalog Number: | BYT-ORB576457-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IF, IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1 |
| Conjugation: | Unconjugated |
| Alternative Names: | Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1 |
| Rabbit polyclonal antibody to TGF beta 1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 43kDa |
| NCBI: | 035707 |
| UniProt: | P04202 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS |
| Target: | TGFB1 |
|
|
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml. |
|
|
Human Spleen |
|
|
Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml. |
|
|
TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml. |
|
|
WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate. |
Product Guarantee and Expert Support
