E2F3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576521
- Bilder (7)
| Artikelname: | E2F3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576521 |
| Hersteller Artikelnummer: | orb576521 |
| Alternativnummer: | BYT-ORB576521-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | E2F-3 |
| Rabbit polyclonal antibody to E2F3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 49 kDa |
| NCBI: | 18140 |
| UniProt: | Q68DT0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK |
| Target-Kategorie: | E2F3 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also present in isoforms of 42 kDa and 37 kDa. |
|
|
Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 0.5 ug/ml. |
|
|
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Thymus. |
Produktgarantie und fachkundiger Support
