Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Target-Kategorie:
E2F3
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also present in isoforms of 42 kDa and 37 kDa.
Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 0.5 ug/ml.
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.