E2F3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB576521
- Images (7)
| Article Name: | E2F3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB576521 |
| Supplier Catalog Number: | orb576521 |
| Alternative Catalog Number: | BYT-ORB576521-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3 |
| Conjugation: | Unconjugated |
| Alternative Names: | E2F-3 |
| Rabbit polyclonal antibody to E2F3 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 49 kDa |
| NCBI: | 18140 |
| UniProt: | Q68DT0 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK |
| Target: | E2F3 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also present in isoforms of 42 kDa and 37 kDa. |
|
|
Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 0.5 ug/ml. |
|
|
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Thymus. |
Product Guarantee and Expert Support
