SOX2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576582
- Bilder (7)
| Artikelname: | SOX2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576582 |
| Hersteller Artikelnummer: | orb576582 |
| Alternativnummer: | BYT-ORB576582-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SOX2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANOP3, MCOPS3 |
| Rabbit polyclonal antibody to SOX2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 34kDa |
| NCBI: | 003097 |
| UniProt: | P48431 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSH |
| Target-Kategorie: | SOX2 |
|
|
Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000. |
|
|
Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: SOX2: Red DAPI:Blue, Gene Name: SOX2. |
|
|
WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3. |
Produktgarantie und fachkundiger Support
