SOX2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB576582
- Images (7)
| Article Name: | SOX2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB576582 |
| Supplier Catalog Number: | orb576582 |
| Alternative Catalog Number: | BYT-ORB576582-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SOX2 |
| Conjugation: | Unconjugated |
| Alternative Names: | ANOP3, MCOPS3 |
| Rabbit polyclonal antibody to SOX2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 34kDa |
| NCBI: | 003097 |
| UniProt: | P48431 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: AGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSH |
| Target: | SOX2 |
|
|
Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000. |
|
|
Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: SOX2: Red DAPI:Blue, Gene Name: SOX2. |
|
|
WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3. |
|
|
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3. |
Product Guarantee and Expert Support
