BRD4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576955
- Bilder (7)
| Artikelname: | BRD4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576955 |
| Hersteller Artikelnummer: | orb576955 |
| Alternativnummer: | BYT-ORB576955-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAP, MCAP, HUNK1, HUNKI |
| Rabbit polyclonal antibody to BRD4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 152 kDa |
| NCBI: | 055114 |
| UniProt: | O60885 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
| Target-Kategorie: | BRD4 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa). |
|
|
Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells. |
|
|
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4. |
|
|
WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus. |
Produktgarantie und fachkundiger Support
