BRD4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB576955
- Images (7)
| Article Name: | BRD4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB576955 |
| Supplier Catalog Number: | orb576955 |
| Alternative Catalog Number: | BYT-ORB576955-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4 |
| Conjugation: | Unconjugated |
| Alternative Names: | CAP, MCAP, HUNK1, HUNKI |
| Rabbit polyclonal antibody to BRD4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 152 kDa |
| NCBI: | 055114 |
| UniProt: | O60885 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
| Target: | BRD4 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa). |
|
|
Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells. |
|
|
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4. |
|
|
WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus. |
Product Guarantee and Expert Support
