GAPDH Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577465
- Bilder (7)
| Artikelname: | GAPDH Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577465 |
| Hersteller Artikelnummer: | orb577465 |
| Alternativnummer: | BYT-ORB577465-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human GAPDH |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G3PD, GAPD, HEL-S-162eP |
| Rabbit polyclonal antibody to GAPDH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 36kDa |
| NCBI: | 002037 |
| UniProt: | P04406 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC |
| Target-Kategorie: | GAPDH |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
Lanes: Lane 1-7: 30 ug rat heart extract, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: GAPDH. |
|
|
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T. |
|
|
WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji. |
Produktgarantie und fachkundiger Support
