GAPDH Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB577465
- Images (7)
| Article Name: | GAPDH Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB577465 |
| Supplier Catalog Number: | orb577465 |
| Alternative Catalog Number: | BYT-ORB577465-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human GAPDH |
| Conjugation: | Unconjugated |
| Alternative Names: | G3PD, GAPD, HEL-S-162eP |
| Rabbit polyclonal antibody to GAPDH |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 36kDa |
| NCBI: | 002037 |
| UniProt: | P04406 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC |
| Target: | GAPDH |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
Lanes: Lane 1-7: 30 ug rat heart extract, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: GAPDH. |
|
|
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T. |
|
|
WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji. |
Product Guarantee and Expert Support
