THOC1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577670
- Bilder (7)
| Artikelname: | THOC1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577670 |
| Hersteller Artikelnummer: | orb577670 |
| Alternativnummer: | BYT-ORB577670-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human THOC1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P84, HPR1, P84N5 |
| Rabbit polyclonal antibody to THOC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 76kDa |
| NCBI: | 005122 |
| UniProt: | Q96FV9 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
| Target-Kategorie: | THOC1 |
|
|
human prostate Primary Antibodies (1:150 dilution). |
|
|
human prostate tumor Primary Antibodies (1:150 dilution). |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Murine Small Intestine, Cellular Data: Crypt-Villus Axis, Antibody Concentration: 0.1 ug/ml, Magnification: 40X. |
|
|
WB Suggested Anti-THOC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
