THOC1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB577670
- Images (7)
| Article Name: | THOC1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB577670 |
| Supplier Catalog Number: | orb577670 |
| Alternative Catalog Number: | BYT-ORB577670-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human THOC1 |
| Conjugation: | Unconjugated |
| Alternative Names: | P84, HPR1, P84N5 |
| Rabbit polyclonal antibody to THOC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 76kDa |
| NCBI: | 005122 |
| UniProt: | Q96FV9 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
| Target: | THOC1 |
|
|
human prostate Primary Antibodies (1:150 dilution). |
|
|
human prostate tumor Primary Antibodies (1:150 dilution). |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-THOC1 Antibody, Paraffin Embedded Tissue: Murine Small Intestine, Cellular Data: Crypt-Villus Axis, Antibody Concentration: 0.1 ug/ml, Magnification: 40X. |
|
|
WB Suggested Anti-THOC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
