TMEM16A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578503
- Bilder (7)
| Artikelname: | TMEM16A Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB578503 |
| Hersteller Artikelnummer: | orb578503 |
| Alternativnummer: | BYT-ORB578503-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human TMEM16A |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DOG1, TAOS2, ORAOV2, TMEM16A |
| Rabbit polyclonal antibody to TMEM16A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 111kDa |
| NCBI: | 060513 |
| UniProt: | Q5XXA6 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
| Target-Kategorie: | ANO1 |
|
|
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: Human Liver, Antibody Dilution: 0.2 ug/ml. |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12. |
|
|
Positive control (+): Human liver (LI), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Muscle. |
Produktgarantie und fachkundiger Support
