TMEM16A Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB578503
Article Name: TMEM16A Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB578503
Supplier Catalog Number: orb578503
Alternative Catalog Number: BYT-ORB578503-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM16A
Conjugation: Unconjugated
Alternative Names: DOG1, TAOS2, ORAOV2, TMEM16A
Rabbit polyclonal antibody to TMEM16A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 111kDa
NCBI: 060513
UniProt: Q5XXA6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
Target: ANO1
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Human Liver, Antibody Dilution: 0.2 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Human liver (LI), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Muscle.