SLC39A6 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578987
- Bilder (7)
| Artikelname: | SLC39A6 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB578987 |
| Hersteller Artikelnummer: | orb578987 |
| Alternativnummer: | BYT-ORB578987-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZIP6, LIV-1 |
| Rabbit polyclonal antibody to SLC39A6 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 85 kDa |
| NCBI: | 001092876 |
| UniProt: | Q13433 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
| Target-Kategorie: | SLC39A6 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 85 kDa and 49 kDa and the protein may be modified by phosphorylation and/or glycosylation. The canonical 85 kDa isoform was undetectable in these samples. |
|
|
Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T. |
|
|
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Human kidney |
|
|
WB Suggested Anti-SLC39A6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
