SLC39A6 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB578987
- Images (7)
| Article Name: | SLC39A6 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB578987 |
| Supplier Catalog Number: | orb578987 |
| Alternative Catalog Number: | BYT-ORB578987-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6 |
| Conjugation: | Unconjugated |
| Alternative Names: | ZIP6, LIV-1 |
| Rabbit polyclonal antibody to SLC39A6 |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 85 kDa |
| NCBI: | 001092876 |
| UniProt: | Q13433 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
| Target: | SLC39A6 |







