SLC39A6 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB578987
- Images (7)
| Article Name: | SLC39A6 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB578987 |
| Supplier Catalog Number: | orb578987 |
| Alternative Catalog Number: | BYT-ORB578987-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6 |
| Conjugation: | Unconjugated |
| Alternative Names: | ZIP6, LIV-1 |
| Rabbit polyclonal antibody to SLC39A6 |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 85 kDa |
| NCBI: | 001092876 |
| UniProt: | Q13433 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
| Target: | SLC39A6 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 85 kDa and 49 kDa and the protein may be modified by phosphorylation and/or glycosylation. The canonical 85 kDa isoform was undetectable in these samples. |
|
|
Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T. |
|
|
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Human kidney |
|
|
WB Suggested Anti-SLC39A6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
