CTH Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB579650
- Bilder (7)
| Artikelname: | CTH Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB579650 |
| Hersteller Artikelnummer: | orb579650 |
| Alternativnummer: | BYT-ORB579650-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CTH |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC9471 |
| Rabbit polyclonal antibody to CTH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 45 kDa |
| NCBI: | 001893 |
| UniProt: | P32929 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF |
| Target-Kategorie: | CTH |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 45 kDa, 41 kDa and 39 kDa. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Type: Human K562 cell lysate, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml. |
|
|
WB Suggested Anti-CTH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
Produktgarantie und fachkundiger Support
