CTH Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB579650
Article Name: CTH Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB579650
Supplier Catalog Number: orb579650
Alternative Catalog Number: BYT-ORB579650-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTH
Conjugation: Unconjugated
Alternative Names: MGC9471
Rabbit polyclonal antibody to CTH
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 45 kDa
NCBI: 001893
UniProt: P32929
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
Target: CTH
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 45 kDa, 41 kDa and 39 kDa.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: Human K562 cell lysate, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.
WB Suggested Anti-CTH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.