Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Target-Kategorie:
PFN1
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.
Lanes: 1. 20 ug human pregnant uterine muscle cells + hormone, 2. 20 ug human pregnant uterine muscle cells - hormone, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.
