PFN1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB580352
Article Name: PFN1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB580352
Supplier Catalog Number: orb580352
Alternative Catalog Number: BYT-ORB580352-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1
Conjugation: Unconjugated
Alternative Names: ALS18
Rabbit polyclonal antibody to PFN1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 15 kDa
NCBI: 005013
UniProt: P07737
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Target: PFN1
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.
Lanes: 1. 20 ug human pregnant uterine muscle cells + hormone, 2. 20 ug human pregnant uterine muscle cells - hormone, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.
Lanes: 1. 20 ug murine non-pregnant uteria tissue, 2. 20 ug murine non-laboring uterine tissue, 3. 20 ug murine laboring uterine tissue, 4. 20 ug murine preterm laboring uterine tissue, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.
Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.