MIEF1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB580726
- Bilder (7)
| Artikelname: | MIEF1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB580726 |
| Hersteller Artikelnummer: | orb580726 |
| Alternativnummer: | BYT-ORB580726-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human SMCR7L |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MID51, SMCR7L, AltMIEF1, HSU79252, MIEF1-MP, dJ1104E15.3 |
| Rabbit polyclonal antibody to MIEF1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 51 kDa |
| NCBI: | 061881 |
| UniProt: | Q9NQG6 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN |
| Target-Kategorie: | MIEF1 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~16 kDa. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): A549 (N03), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate. SMCR7L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells. |
Produktgarantie und fachkundiger Support
