MIEF1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB580726
Article Name: MIEF1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB580726
Supplier Catalog Number: orb580726
Alternative Catalog Number: BYT-ORB580726-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMCR7L
Conjugation: Unconjugated
Alternative Names: MID51, SMCR7L, AltMIEF1, HSU79252, MIEF1-MP, dJ1104E15.3
Rabbit polyclonal antibody to MIEF1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 51 kDa
NCBI: 061881
UniProt: Q9NQG6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN
Target: MIEF1
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~16 kDa.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Positive control (+): A549 (N03), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.
WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate. SMCR7L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.