YAP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581119
- Bilder (7)
| Artikelname: | YAP1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581119 |
| Hersteller Artikelnummer: | orb581119 |
| Alternativnummer: | BYT-ORB581119-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human YAP1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | YAP, YKI, COB1, YAP2, YAP65 |
| Rabbit polyclonal antibody to YAP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 54kDa |
| NCBI: | 001123617 |
| UniProt: | P46937 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
| Target-Kategorie: | YAP1 |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Fetal Liver lysates, Antibody dilution: 3 ug/ml. |
|
|
Sample Type: Human Fetal Lung cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. |
|
|
Positive control (+): HepG2 (HG), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml. |
|
|
Human Prostate |
|
|
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-YAP1 antibody (orb581119). |
|
|
WB Suggested Anti-YAP1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate. |
Produktgarantie und fachkundiger Support
