YAP1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB581119
| Article Name: |
YAP1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB581119 |
| Supplier Catalog Number: |
orb581119 |
| Alternative Catalog Number: |
BYT-ORB581119-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human YAP1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
YAP, YKI, COB1, YAP2, YAP65 |
| Rabbit polyclonal antibody to YAP1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
54kDa |
| NCBI: |
001123617 |
| UniProt: |
P46937 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
| Target: |
YAP1 |
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
Sample Type: Fetal Liver lysates, Antibody dilution: 3 ug/ml. |
|
Sample Type: Human Fetal Lung cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. |
|
Positive control (+): HepG2 (HG), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml. |
|
Human Prostate |
|
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-YAP1 antibody (orb581119). |
|
WB Suggested Anti-YAP1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate. |