NTRK3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581342
- Bilder (7)
| Artikelname: | NTRK3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581342 |
| Hersteller Artikelnummer: | orb581342 |
| Alternativnummer: | BYT-ORB581342-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TRKC, GP145-TrkC, gp145(trkC) |
| Rabbit polyclonal antibody to NTRK3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 89kDa |
| NCBI: | 002521 |
| UniProt: | Q16288 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
| Target-Kategorie: | NTRK3 |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml. |
|
|
Rabbit Anti-NTRK3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cerebellum, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver. |
Produktgarantie und fachkundiger Support
