NTRK3 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB581342
Article Name: NTRK3 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB581342
Supplier Catalog Number: orb581342
Alternative Catalog Number: BYT-ORB581342-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3
Conjugation: Unconjugated
Alternative Names: TRKC, GP145-TrkC, gp145(trkC)
Rabbit polyclonal antibody to NTRK3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 89kDa
NCBI: 002521
UniProt: Q16288
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Target: NTRK3
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Rabbit Anti-NTRK3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cerebellum, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.