CHI3L1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581500
- Bilder (7)
| Artikelname: | CHI3L1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581500 |
| Hersteller Artikelnummer: | orb581500 |
| Alternativnummer: | BYT-ORB581500-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IF, WB |
| Spezies Reaktivität: | Human, Monkey |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39 |
| Rabbit polyclonal antibody to CHI3L1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 43 kDa |
| NCBI: | 001267 |
| UniProt: | P36222 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL |
| Target-Kategorie: | CHI3L1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
simian immunodeficiency virus encephalitis. |
|
|
WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
