CHI3L1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB581500
- Images (7)
| Article Name: | CHI3L1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB581500 |
| Supplier Catalog Number: | orb581500 |
| Alternative Catalog Number: | BYT-ORB581500-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IF, WB |
| Species Reactivity: | Human, Monkey |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1 |
| Conjugation: | Unconjugated |
| Alternative Names: | GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39 |
| Rabbit polyclonal antibody to CHI3L1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 43 kDa |
| NCBI: | 001267 |
| UniProt: | P36222 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL |
| Target: | CHI3L1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
simian immunodeficiency virus encephalitis. |
|
|
WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
