APOA2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB582397
- Bilder (7)
| Artikelname: | APOA2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB582397 |
| Hersteller Artikelnummer: | orb582397 |
| Alternativnummer: | BYT-ORB582397-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human APOA2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | apoAII, Apo-AII, ApoA-II |
| Rabbit polyclonal antibody to APOA2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 11 kDa |
| NCBI: | 001634 |
| UniProt: | P02652 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
| Target-Kategorie: | APOA2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by phosphorylation. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells. |
|
|
WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate. |
Produktgarantie und fachkundiger Support
