Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Target:
APOA2
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by phosphorylation.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.