FMOD Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB582408
- Bilder (7)
| Artikelname: | FMOD Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB582408 |
| Hersteller Artikelnummer: | orb582408 |
| Alternativnummer: | BYT-ORB582408-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Equine, Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FM, SLRR2E |
| Rabbit polyclonal antibody to FMOD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 43kDa |
| NCBI: | 002014 |
| UniProt: | Q06828 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER |
| Target-Kategorie: | FMOD |
|
|
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): 293T (2T), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml. |
|
|
Sample Type: Equine Cartilage Explants, Primary dilution: 1:500. |
|
|
WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |
Produktgarantie und fachkundiger Support
