FMOD Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB582408
- Images (7)
| Article Name: | FMOD Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB582408 |
| Supplier Catalog Number: | orb582408 |
| Alternative Catalog Number: | BYT-ORB582408-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Equine, Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD |
| Conjugation: | Unconjugated |
| Alternative Names: | FM, SLRR2E |
| Rabbit polyclonal antibody to FMOD |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 43kDa |
| NCBI: | 002014 |
| UniProt: | Q06828 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER |
| Target: | FMOD |
|
|
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): 293T (2T), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml. |
|
|
Sample Type: Equine Cartilage Explants, Primary dilution: 1:500. |
|
|
WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |
Product Guarantee and Expert Support
