PRPSAP2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB583163
- Bilder (7)
| Artikelname: | PRPSAP2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB583163 |
| Hersteller Artikelnummer: | orb583163 |
| Alternativnummer: | BYT-ORB583163-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRPSAP2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PAP41 |
| Rabbit polyclonal antibody to PRPSAP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 41kDa |
| NCBI: | 002758 |
| UniProt: | O60256 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ |
| Target-Kategorie: | PRPSAP2 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B. |
|
|
Sample Type: Hela Whole cell lysates, Antibody dilution: 2.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:100, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
