PRPSAP2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB583163
- Images (7)
| Article Name: | PRPSAP2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB583163 |
| Supplier Catalog Number: | orb583163 |
| Alternative Catalog Number: | BYT-ORB583163-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRPSAP2 |
| Conjugation: | Unconjugated |
| Alternative Names: | PAP41 |
| Rabbit polyclonal antibody to PRPSAP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 41kDa |
| NCBI: | 002758 |
| UniProt: | O60256 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ |
| Target: | PRPSAP2 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B. |
|
|
Sample Type: Hela Whole cell lysates, Antibody dilution: 2.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:100, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
