CRTAC1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB583444
- Bilder (7)
| Artikelname: | CRTAC1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB583444 |
| Hersteller Artikelnummer: | orb583444 |
| Alternativnummer: | BYT-ORB583444-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CRTAC1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASPIC, CEP68, LOTUS, ASPIC1, CEP-68 |
| Rabbit polyclonal antibody to CRTAC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 71 kDa |
| NCBI: | 060528 |
| UniProt: | Q9NQ79 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK |
| Target-Kategorie: | CRTAC1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Positive control (+): HeLa cell lysate (HL), Negative control (-): HepG2 cell lysate (HG), Antibody concentration: 3 ug/ml. |
|
|
WB Suggested Anti-CRTAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
