CRTAC1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB583444
- Images (7)
| Article Name: | CRTAC1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB583444 |
| Supplier Catalog Number: | orb583444 |
| Alternative Catalog Number: | BYT-ORB583444-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CRTAC1 |
| Conjugation: | Unconjugated |
| Alternative Names: | ASPIC, CEP68, LOTUS, ASPIC1, CEP-68 |
| Rabbit polyclonal antibody to CRTAC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 71 kDa |
| NCBI: | 060528 |
| UniProt: | Q9NQ79 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK |
| Target: | CRTAC1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Positive control (+): HeLa cell lysate (HL), Negative control (-): HepG2 cell lysate (HG), Antibody concentration: 3 ug/ml. |
|
|
WB Suggested Anti-CRTAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
