Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Target-Kategorie:
FOXM1
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.
Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).
Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate, Lane 3: 25 ug Huh-7 cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: FOXM1.