FOXM1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB592704
- Images (8)
| Article Name: | FOXM1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB592704 |
| Supplier Catalog Number: | orb592704 |
| Alternative Catalog Number: | BYT-ORB592704-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human FOXM1 |
| Conjugation: | Unconjugated |
| Alternative Names: | MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, TRIDENT, MPHOSPH2 |
| Rabbit polyclonal antibody to FOXM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 84kDa |
| NCBI: | 068772 |
| UniProt: | Q08050 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ |
| Target: | FOXM1 |
|
|
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml. |
|
|
Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704). |
|
|
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704). |
|
|
Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate, Lane 3: 25 ug Huh-7 cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: FOXM1. |
|
|
WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
