Mouse Il7 protein

Artikelnummer: BYT-ORB594833
Artikelname: Mouse Il7 protein
Artikelnummer: BYT-ORB594833
Hersteller Artikelnummer: orb594833
Alternativnummer: BYT-ORB594833-10,BYT-ORB594833-50,BYT-ORB594833-500,BYT-ORB594833-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL-7, IL-7 interleukin-7, interleukin-7, Lymphopoietin -1, PBGF
This Mouse Il7 protein spans the amino acid sequence from region 26-154aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 15.9 kDa
UniProt: P10168
Puffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL