Mouse Il7 protein

Catalog Number: BYT-ORB594833
Article Name: Mouse Il7 protein
Biozol Catalog Number: BYT-ORB594833
Supplier Catalog Number: orb594833
Alternative Catalog Number: BYT-ORB594833-10,BYT-ORB594833-50,BYT-ORB594833-500,BYT-ORB594833-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IL-7, IL-7 interleukin-7, interleukin-7, Lymphopoietin -1, PBGF
This Mouse Il7 protein spans the amino acid sequence from region 26-154aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.9 kDa
UniProt: P10168
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL