Mouse Il10 protein

Artikelnummer: BYT-ORB594838
Artikelname: Mouse Il10 protein
Artikelnummer: BYT-ORB594838
Hersteller Artikelnummer: orb594838
Alternativnummer: BYT-ORB594838-10,BYT-ORB594838-50,BYT-ORB594838-500,BYT-ORB594838-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-10,Il10,IL-10,Cytokine synthesis inhibitory factor,CSIF,
This Mouse Il10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 18.9 kDa
UniProt: P18893
Puffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL