Mouse Il10 protein

Catalog Number: BYT-ORB594838
Article Name: Mouse Il10 protein
Biozol Catalog Number: BYT-ORB594838
Supplier Catalog Number: orb594838
Alternative Catalog Number: BYT-ORB594838-10,BYT-ORB594838-50,BYT-ORB594838-500,BYT-ORB594838-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-10,Il10,IL-10,Cytokine synthesis inhibitory factor,CSIF,
This Mouse Il10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 18.9 kDa
UniProt: P18893
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL