Human DGKA protein

Artikelnummer: BYT-ORB594970
Artikelname: Human DGKA protein
Artikelnummer: BYT-ORB594970
Hersteller Artikelnummer: orb594970
Alternativnummer: BYT-ORB594970-20,BYT-ORB594970-100,BYT-ORB594970-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 80 kDa diacylglycerol kinase (Diglyceride kinase alpha) (DGK-alpha) (DAG kinase alpha) (DAGK) (DAGK1)
This Human DGKA protein spans the amino acid sequence from region 1-735aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 86.7 kDa
UniProt: P23743
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) DGKA.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) DGKA.