Human DGKA protein

Catalog Number: BYT-ORB594970
Article Name: Human DGKA protein
Biozol Catalog Number: BYT-ORB594970
Supplier Catalog Number: orb594970
Alternative Catalog Number: BYT-ORB594970-20,BYT-ORB594970-100,BYT-ORB594970-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 80 kDa diacylglycerol kinase (Diglyceride kinase alpha) (DGK-alpha) (DAG kinase alpha) (DAGK) (DAGK1)
This Human DGKA protein spans the amino acid sequence from region 1-735aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 86.7 kDa
UniProt: P23743
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) DGKA.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) DGKA.